PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00098088001
Common NameGSBRNA2T00098088001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 302aa    MW: 33520.9 Da    PI: 6.2664
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00098088001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.62e-31160215156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++WtpeLH+rFv+a++ LGG+ +AtPk+i+e+m+ +gLt+++vkSHLQkYRl+
  GSBRNA2T00098088001 160 KQRRCWTPELHRRFVDALQLLGGPGVATPKQIREHMQEEGLTNDEVKSHLQKYRLH 215
                          79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.052157217IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-27158218IPR009057Homeodomain-like
SuperFamilySSF466899.86E-18158218IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-26160215IPR006447Myb domain, plants
PfamPF002495.1E-9162213IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MGSLGDELSL GSRRHCSIPT KPSKIMNVKK LEEEKIKIES SDLELPLCLQ ILNDAILYLK  60
EENKRCSEMD TQPLLKDFIS PLLWREDNNK LDIERNEEKS LSGLPMLLKT PEVETGLGLG  120
LASSSMVNGG RRKGTASCGF NSNSVPQLPP YLQQQALSRK QRRCWTPELH RRFVDALQLL  180
GGPGVATPKQ IREHMQEEGL TNDEVKSHLQ KYRLHIRKSN SNLEKQSLVV LGFNLWNSSS  240
KEEEEGTGEG GGSSKRSNSL SDSPQGPLHL PCTTTTTTTG GDSCMEDAED AKSESFQIWR  300
D*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00193DAPTransfer from AT1G49560Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00098088001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013646404.10.0PREDICTED: uncharacterized protein LOC106351132 isoform X2
TrEMBLA0A078IPQ50.0A0A078IPQ5_BRANA; BnaA06g03110D protein
STRINGBra018794.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139271824
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49560.11e-91G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]